PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1646660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 163aa    MW: 19133.1 Da    PI: 9.3014
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1646660.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.45.5e-57161421129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
  Lj4g3v1646660.1  16 LPPGFRFHPTDEELISHYLYKKVIDIEFSA-RAIGEVDLNKCEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFR 108
                      79**************************99.89***************888999**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++lvg+kktLvfykgrapkgek++Wvmheyrle
  Lj4g3v1646660.1 109 -GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142
                      .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-6212153IPR003441NAC domain
PROSITE profilePS5100555.6616163IPR003441NAC domain
PfamPF023653.9E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MENISVLSKE EDQMDLPPGF RFHPTDEELI SHYLYKKVID IEFSARAIGE VDLNKCEPWD  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIFRGK SLVGMKKTLV  120
FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKVIDCP VFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-531314117145NAC domain-containing protein 19
3swp_C5e-531314117145NAC domain-containing protein 19
3swp_B5e-531314117145NAC domain-containing protein 19
3swp_A5e-531314117145NAC domain-containing protein 19
3swm_D5e-531314117145NAC domain-containing protein 19
3swm_C5e-531314117145NAC domain-containing protein 19
3swm_B5e-531314117145NAC domain-containing protein 19
3swm_A5e-531314117145NAC domain-containing protein 19
4dul_B5e-531314114142NAC domain-containing protein 19
4dul_A5e-531314114142NAC domain-containing protein 19
1ut7_B5e-531314114142NO APICAL MERISTEM PROTEIN
1ut7_A5e-531314114142NO APICAL MERISTEM PROTEIN
1ut4_B5e-531314114142NO APICAL MERISTEM PROTEIN
1ut4_A5e-531314114142NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0941591e-144BT094159.1 Soybean clone JCVI-FLGm-18C12 unknown mRNA.
GenBankEU6619251e-144EU661925.1 Glycine max NAC domain protein (NAC28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080293.11e-106PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-101NC100_ARATH; NAC domain-containing protein 100
TrEMBLC6T9I71e-106C6T9I7_SOYBN; Putative uncharacterized protein (Fragment)
TrEMBLR4N7I91e-106R4N7I9_JATCU; NAC transcription factor 002
STRINGGLYMA17G10970.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-102NAC domain containing protein 100